Recombinant Human MAP4K5 protein, His-tagged

• Cat.No.: MAP4K5-3979H
• Product Overview: Recombinant Human MAP4K5 protein(5-274 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 5-274 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: LRPAADILRRNPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVEKNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTH
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MAP4K5 mitogen-activated protein kinase kinase kinase kinase 5 [ Homo sapiens ]
• Official Symbol: MAP4K5
• Synonyms: MAP4K5; mitogen-activated protein kinase kinase kinase kinase 5; GCKR; germinal center kinase related; KHS; KHS1; MEKKK 5; MEK kinase kinase 5; germinal center kinase-related; MAPK/ERK kinase kinase kinase 5; kinase homologous to SPS1/STE20; MAPKKKK5
• Gene ID: 11183
• mRNA Refseq: NM_006575
• Protein Refseq: NP_006566
• MIM: 604923
• UniProt ID: Q9Y4K4