Recombinant Human MAP4

Cat.No. : MAP4-29752TH
Product Overview : Recombinant full length Human MAP4 (aa 1-99) with N-terminal proprietary tag, 36.96 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : The protein encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MAPT/TAU). This protein promotes microtubule assembly, and has been shown to counteract destabilization of interphase microtubule catastrophe promotion. Cyclin B was found to interact with this protein, which targets cell division cycle 2 (CDC2) kinase to microtubules. The phosphorylation of this protein affects microtubule properties and cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.960kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA
Sequence Similarities : Contains 4 Tau/MAP repeats.
Gene Name MAP4 microtubule-associated protein 4 [ Homo sapiens ]
Official Symbol MAP4
Synonyms MAP4; microtubule-associated protein 4;
Gene ID 4134
mRNA Refseq NM_001134364
Protein Refseq NP_001127836
MIM 157132
Uniprot ID P27816
Chromosome Location 3p21
Function protein binding; structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MAP4 Products

Required fields are marked with *

My Review for All MAP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon