Recombinant Human MANBAL Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MANBAL-3183H
• Product Overview: MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_071360) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: MANBAL (Mannosidase Beta Like) is a Protein Coding gene. Diseases associated with MANBAL include Colorectal Cancer, Hereditary Nonpolyposis, Type 7.
• Molecular Mass: 9.5 kDa
• AA Sequence: MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MANBAL mannosidase beta like [ Homo sapiens (human) ]
• Official Symbol: MANBAL
• Synonyms: MANBAL; mannosidase beta like; protein MANBAL; mannosidase beta A like; mannosidase, beta A, lysosomal-like
• Gene ID: 63905
• mRNA Refseq: NM_022077
• Protein Refseq: NP_071360
• UniProt ID: Q9NQG1