Recombinant Human MAL Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MAL-2790H |
Product Overview : | MAL MS Standard C13 and N15-labeled recombinant protein (NP_071883) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3. |
Molecular Mass : | 11.9 kDa |
AA Sequence : | MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLVFSYIATLLYVVHAVFSLIRWKSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MAL mal, T cell differentiation protein [ Homo sapiens (human) ] |
Official Symbol | MAL |
Synonyms | MAL; mal, T-cell differentiation protein; myelin and lymphocyte protein; T-cell differentiation protein MAL; T-lymphocyte maturation-associated protein; |
Gene ID | 4118 |
mRNA Refseq | NM_022438 |
Protein Refseq | NP_071883 |
MIM | 188860 |
UniProt ID | P21145 |
◆ Recombinant Proteins | ||
MAL-5307M | Recombinant Mouse MAL Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28887RF | Recombinant Full Length Rat Myelin And Lymphocyte Protein(Mal) Protein, His-Tagged | +Inquiry |
MAL-3204R | Recombinant Rat MAL Protein, His (Fc)-Avi-tagged | +Inquiry |
MAL-9470M | Recombinant Mouse MAL Protein | +Inquiry |
MAL-3548R | Recombinant Rat MAL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAL-4530HCL | Recombinant Human MAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAL Products
Required fields are marked with *
My Review for All MAL Products
Required fields are marked with *
0
Inquiry Basket