Recombinant Human MAD2L2 protein, His-tagged

• Cat.No.: MAD2L2-2787H
• Product Overview: Recombinant Human MAD2L2 protein(2-211 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 2-211 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: TTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MAD2L2 MAD2 mitotic arrest deficient-like 2 (yeast) [ Homo sapiens ]
• Official Symbol: MAD2L2
• Synonyms: MAD2L2; MAD2 mitotic arrest deficient-like 2 (yeast); MAD2 (mitotic arrest deficient, yeast, homolog) like 2; mitotic spindle assembly checkpoint protein MAD2B; MAD2B; mitotic arrest deficient homolog like 2; REV7; hREV7; REV7 homolog; MAD2-like protein 2; mitotic arrest deficient homolog-like 2; mitotic arrest deficient 2-like protein 2; MAD2 (mitotic arrest deficient, yeast, homolog)-like 2
• Gene ID: 10459
• mRNA Refseq: NM_001127325
• Protein Refseq: NP_001120797
• MIM: 604094
• UniProt ID: Q9UI95