Recombinant Human MAD2L1, His-tagged

Cat.No. : MAD2L1-28857TH
Product Overview : Recombinant full length Human Mad2L1 with an N terminal His tag ; mwt: 25.7 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 205 amino acids
Description : MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate.MAD2L1 is related to the MAD2L2 gene located on chromosome 1.A MAD2 pseudogene has been mapped to chromosome 14.
Conjugation : HIS
Molecular Weight : 25.700kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Sequence Similarities : Belongs to the MAD2 family.Contains 1 HORMA domain.
Gene Name MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) [ Homo sapiens ]
Official Symbol MAD2L1
Synonyms MAD2L1; MAD2 mitotic arrest deficient-like 1 (yeast); MAD2 (mitotic arrest deficient, yeast, homolog) like 1; mitotic spindle assembly checkpoint protein MAD2A; HSMAD2; MAD2;
Gene ID 4085
mRNA Refseq NM_002358
Protein Refseq NP_002349
MIM 601467
Uniprot ID Q13257
Chromosome Location 4q27
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Amplificationof signal from unattachedkinetochores via a MAD2inhibitory signal, organism-specific biosystem; Amplification of signal from the kinetochores, organism-specific biosystem;
Function protein binding; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MAD2L1 Products

Required fields are marked with *

My Review for All MAD2L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon