Recombinant Human LYRM7 protein, GST-tagged

• Cat.No.: LYRM7-301221H
• Product Overview: Recombinant Human LYRM7 (1-104 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Met1-Gln104
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDIELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage

Gene Information

• Gene Name: LYRM7 LYR motif containing 7 [ Homo sapiens (human) ]
• Official Symbol: LYRM7
• Synonyms: MZM1L; MC3DN8; C5orf31
• Gene ID: 90624
• mRNA Refseq: NM_001293735
• Protein Refseq: NP_001280664
• MIM: 615831