Recombinant Human LYPLA2 Protein, GST-tagged

• Cat.No.: LYPLA2-4547H
• Product Overview: Human LYPLA2 full-length ORF ( NP_009191.1, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq
• Molecular Mass: 51.1 kDa
• AA Sequence: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYPLA2 lysophospholipase II [ Homo sapiens ]
• Official Symbol: LYPLA2
• Synonyms: LYPLA2; lysophospholipase II; acyl-protein thioesterase 2; APT 2; LPL-II; lysoPLA II; APT-2; DJ886K2.4
• Gene ID: 11313
• mRNA Refseq: NM_007260
• Protein Refseq: NP_009191
• UniProt ID: O95372