Recombinant Human LY6K protein, His&Myc-tagged
Cat.No. : | LY6K-6765H |
Product Overview : | Recombinant Human LY6K protein(Q17RY6)(18-138aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 18-138aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG |
Gene Name | LY6K lymphocyte antigen 6 complex, locus K [ Homo sapiens ] |
Official Symbol | LY6K |
Synonyms | LY6K; lymphocyte antigen 6 complex, locus K; lymphocyte antigen 6K; cancer/testis antigen 97; CT97; FLJ35226; HSJ001348; ly-6K; |
Gene ID | 54742 |
mRNA Refseq | NM_001160354 |
Protein Refseq | NP_001153826 |
UniProt ID | Q17RY6 |
◆ Recombinant Proteins | ||
Ly6k-5833M | Recombinant Mouse Ly6k protein, His-tagged | +Inquiry |
LY6K-5257M | Recombinant Mouse LY6K Protein, His (Fc)-Avi-tagged | +Inquiry |
LY6K-46H | Recombinant Human LY6K protein, MYC/DDK-tagged | +Inquiry |
LY6K-698HF | Recombinant Full Length Human LY6K Protein, GST-tagged | +Inquiry |
Ly6k-3872M | Recombinant Mouse Ly6k Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6K-4597HCL | Recombinant Human LY6K 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY6K Products
Required fields are marked with *
My Review for All LY6K Products
Required fields are marked with *
0
Inquiry Basket