Recombinant Human LY6K protein, His&Myc-tagged

• Cat.No.: LY6K-6765H
• Product Overview: Recombinant Human LY6K protein(Q17RY6)(18-138aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 18-138aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG

Gene Information

• Gene Name: LY6K lymphocyte antigen 6 complex, locus K [ Homo sapiens ]
• Official Symbol: LY6K
• Synonyms: LY6K; lymphocyte antigen 6 complex, locus K; lymphocyte antigen 6K; cancer/testis antigen 97; CT97; FLJ35226; HSJ001348; ly-6K
• Gene ID: 54742
• mRNA Refseq: NM_001160354
• Protein Refseq: NP_001153826
• UniProt ID: Q17RY6