Recombinant Human LY6H Protein, GST-tagged

• Cat.No.: LY6H-4568H
• Product Overview: Human LY6H full-length ORF ( AAH28894, 26 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: LY6H (Lymphocyte Antigen 6 Family Member H) is a Protein Coding gene. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 38.39 kDa
• AA Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LY6H lymphocyte antigen 6 complex, locus H [ Homo sapiens ]
• Official Symbol: LY6H
• Synonyms: LY6H; lymphocyte antigen 6 complex, locus H; lymphocyte antigen 6H; NMLY6; ly-6H
• Gene ID: 4062
• mRNA Refseq: NM_001130478
• Protein Refseq: NP_001123950
• MIM: 603625
• UniProt ID: O94772