Recombinant Human LY6H, His-tagged

• Cat.No.: LY6H-131H
• Product Overview: Recombinant Human Lymphocyte Antigen 6H/LY6H is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu26-Gly115) of Human LY6H fused with a polyhistidine tag at the C-terminus.

Specification

• Description: Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is removed in the mature form, and a 90 amino acid mature chain. LY6H is highly expressed in the brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in acute human leukemic cell line MOLT-3. It is also found in lower levels in testis, pancreas, small intestine and colon. It has been shown that LY6H may play a role in both the central nervous system and the immune system.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLM GFINSGILKVDVDCCEKDLCNGAAGLDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Protein length: 26-115 a.a.

Gene Information

• Gene Name: LY6H lymphocyte antigen 6 complex, locus H [ Homo sapiens ]
• Official Symbol: LY6H
• Synonyms: LY6H; lymphocyte antigen 6 complex, locus H; lymphocyte antigen 6H; NMLY6; ly-6H
• Gene ID: 4062
• mRNA Refseq: NM_001130478
• Protein Refseq: NP_001123950
• MIM: 603625
• UniProt ID: O94772
• Chromosome Location: 8q24.3