Recombinant Human LXN Protein, GST-tagged

• Cat.No.: LXN-4573H
• Product Overview: Human LXN full-length ORF ( NP_064554.2, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 52.2 kDa
• AA Sequence: MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LXN latexin [ Homo sapiens ]
• Official Symbol: LXN
• Synonyms: LXN; latexin; MUM; tissue carboxypeptidase inhibitor; endogenous carboxypeptidase inhibitor; ECI; TCI
• Gene ID: 56925
• mRNA Refseq: NM_020169
• Protein Refseq: NP_064554
• MIM: 609305
• UniProt ID: Q9BS40