Recombinant Human LVRN Protein, GST-tagged

• Cat.No.: LVRN-4357H
• Product Overview: Human FLJ90650 full-length ORF ( AAH45809.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: LVRN (Laeverin) is a Protein Coding gene. Diseases associated with LVRN include Chronic Laryngitis. GO annotations related to this gene include metallopeptidase activity. An important paralog of this gene is ANPEP.
• Molecular Mass: 49.6 kDa
• AA Sequence: MKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITLNVSTGVMKQEPFYLENIKNRTLLTSNDTWIVPILWIKNGTTQPLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKMR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LVRN laeverin [ Homo sapiens (human) ]
• Official Symbol: LVRN
• Synonyms: LVRN; laeverin; APQ; AQPEP; TAQPEP; aminopeptidase Q; AP-Q; CHL2 antigen
• Gene ID: 206338
• mRNA Refseq: NM_173800
• Protein Refseq: NP_776161
• MIM: 610046
• UniProt ID: Q6Q4G3