Recombinant Human LRRN4CL Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LRRN4CL-5764H
Product Overview : LRRN4CL MS Standard C13 and N15-labeled recombinant protein (NP_981967) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LRRN4CL (LRRN4 C-Terminal Like) is a Protein Coding gene. An important paralog of this gene is LRRN4.
Molecular Mass : 25.1 kDa
AA Sequence : MLGSPCLLWLLAVTFLVPRAQPLAPQDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCAPFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAANEAGASRVPQAGGEGLEGADIPAFGPCSRLAVPPNPRTLVHAAVGVGTALALLSCAALVWHFCLRDRWGCPRRAAARAAGALTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LRRN4CL LRRN4 C-terminal like [ Homo sapiens (human) ]
Official Symbol LRRN4CL
Synonyms LRRN4CL; LRRN4 C-terminal like; LRRN4 C-terminal-like protein
Gene ID 221091
mRNA Refseq NM_203422
Protein Refseq NP_981967
UniProt ID Q8ND94

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LRRN4CL Products

Required fields are marked with *

My Review for All LRRN4CL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon