Recombinant Human LRRK2 Protein, GST-tagged

• Cat.No.: LRRK2-4634H
• Product Overview: Human LRRK2 partial ORF ( AAV63975, 2161 a.a. - 2260 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane. Mutations in this gene have been associated with Parkinson disease-8. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRK2 leucine-rich repeat kinase 2 [ Homo sapiens ]
• Official Symbol: LRRK2
• Synonyms: LRRK2; leucine-rich repeat kinase 2; PARK8, Parkinson disease (autosomal dominant) 8; leucine-rich repeat serine/threonine-protein kinase 2; DKFZp434H2111; FLJ45829; RIPK7; ROCO2; augmented in rheumatoid arthritis 17; PARK8; AURA17; DARDARIN
• Gene ID: 120892
• mRNA Refseq: NM_198578
• Protein Refseq: NP_940980
• MIM: 609007
• UniProt ID: Q5S007