Recombinant Human LRRC8A Protein, GST-tagged

• Cat.No.: LRRC8A-4646H
• Product Overview: Human LRRC8A partial ORF ( NP_062540.2, 711 a.a. - 810 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRC8A leucine rich repeat containing 8 VRAC subunit A [ Homo sapiens (human) ]
• Official Symbol: LRRC8A
• Synonyms: LRRC8A; leucine rich repeat containing 8 VRAC subunit A; AGM5; LRRC8; SWELL1; volume-regulated anion channel subunit LRRC8A; leucine rich repeat containing 8 family member A; leucine-rich repeat-containing protein 8A; swelling protein 1
• Gene ID: https://www.ncbi.nlm.nih.gov/gene/?term=56262
• mRNA Refseq: NM_001127244
• Protein Refseq: NP_001120716
• MIM: 608360
• UniProt ID: Q8IWT6