Recombinant Human LRRC41 Protein, GST-tagged

• Cat.No.: LRRC41-4666H
• Product Overview: Human LRRC41 partial ORF ( NP_006360, 86 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LRRC41 (Leucine Rich Repeat Containing 41) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include protein homodimerization activity.
• Molecular Mass: 37.84 kDa
• AA Sequence: ERIEETALKKGLSTQAIWRRLWDELMKTRPSSLESVTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELVAEPNRRVLETLASSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRC41 leucine rich repeat containing 41 [ Homo sapiens ]
• Official Symbol: LRRC41
• Synonyms: LRRC41; leucine rich repeat containing 41; leucine-rich repeat-containing protein 41; MUF1; protein Muf1; MUF1 protein (MUF1); elongin BC-interacting leucine-rich repeat protein; PP7759; RP4-636H5.2; MGC126571; MGC126573
• Gene ID: 10489
• mRNA Refseq: NM_006369
• Protein Refseq: NP_006360
• UniProt ID: Q15345