Recombinant Human LRRC29 Protein, GST-tagged

• Cat.No.: LRRC29-4674H
• Product Overview: Human LRRC29 full-length ORF ( NP_001004055.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 9 tandem leucine-rich repeats. Two transcript variants encoding the same protein have been found for this gene. Other variants may occur, but their full-length natures have not been characterized. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 50.2 kDa
• AA Sequence: MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRC29 leucine rich repeat containing 29 [ Homo sapiens ]
• Official Symbol: LRRC29
• Synonyms: LRRC29; leucine rich repeat containing 29; F box and leucine rich repeat protein 9 , FBXL9; leucine-rich repeat-containing protein 29; FBL9; F-box protein FBL9; F-box/LRR-repeat protein 9; F-box and leucine-rich repeat protein 9; FBXL9
• Gene ID: 26231
• mRNA Refseq: NM_001004055
• Protein Refseq: NP_001004055
• UniProt ID: Q8WV35