Recombinant Human LRRC17 Protein, GST-tagged

• Cat.No.: LRRC17-4683H
• Product Overview: Human LRRC17 full-length ORF ( AAH27903, 19 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: LRRC17 (Leucine Rich Repeat Containing 17) is a Protein Coding gene. Diseases associated with LRRC17 include Neuroblastoma. An important paralog of this gene is LRRC3.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 72.27 kDa
• AA Sequence: RKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDNPWRCDYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVIITIVG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRC17 leucine rich repeat containing 17 [ Homo sapiens ]
• Official Symbol: LRRC17
• Synonyms: LRRC17; leucine rich repeat containing 17; leucine-rich repeat-containing protein 17; H_RG318M05.3; P37NB; 37 kDa leucine-rich repeat (LRR) protein
• Gene ID: 10234
• mRNA Refseq: NM_001031692
• Protein Refseq: NP_001026862
• UniProt ID: Q8N6Y2