Recombinant Human LOC90768 Protein, GST-tagged

• Cat.No.: LOC90768-5288H
• Product Overview: Human MGC45800 full-length ORF ( AAH33172.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LOC90768 (Uncharacterized LOC90768) is an RNA Gene, and is affiliated with the ncRNA class.
• Molecular Mass: 42.2 kDa
• AA Sequence: MGDLSRTALWLGGRRDPSGSFRVRDGAAAEVGRACLGLPSECGSLVRARASPRPLLGPAVGPWRARSPRPGLPRPSPTCPWKRGGDWCALSLVAPAASRHPPLSASEQRIPPTSTCTCTRPLGNPLAFLTTVQNQKQIEHWENKDDAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LOC90768 uncharacterized LOC90768 [ Homo sapiens (human) ]
• Official Symbol: LOC90768
• Synonyms: LOC90768; uncharacterized LOC90768
• Gene ID: 90768