Recombinant Human LOC403312 Protein, GST-tagged

• Cat.No.: LOC403312-5277H
• Product Overview: Human MGC39545 full-length ORF ( AAH36197.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LOC403312 (Putative Uncharacterized Protein MGC39545) is a Protein Coding gene.
• Molecular Mass: 47.6 kDa
• AA Sequence: MPSGEERRDRQKGRRAGCDTSSTPSNTAPRIPEPGAHPTAARPATAQPPRSLLPPVCSKTIAPPASAAAASGSDTAGMRGLGKAPHSGEGHERGRGNSKMKACNNYQYGYLAKPDTSFWIKCRRWLLADAGRHTQRPFWTFRVSHSPLLEAEAGRPSDVSQLQLGSDLKPKMRRPAGELFSPKDAGWELDPAEKSE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LOC403312 putative uncharacterized protein MGC39545 [ Homo sapiens (human) ]
• Official Symbol: LOC403312
• Synonyms: LOC403312; putative uncharacterized protein MGC39545; putative uncharacterized protein MGC39545
• Gene ID: 403312
• mRNA Refseq: NM_001301851
• Protein Refseq: NP_001288780