Recombinant Human LOC399886 Protein, GST-tagged

• Cat.No.: LOC399886-4337H
• Product Overview: Human FLJ41423 full-length ORF ( ADR83482.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: LOC399886 (Uncharacterized LOC399886) is an RNA Gene, and is affiliated with the ncRNA class.
• Molecular Mass: 18.4 kDa
• AA Sequence: MAALSSRCPRSAAGPAYLQEAARSAHWASPPLVPLRTFQSSLFSSGSFHSREEEEEGVSLLRTALVGQGPVPLFLGSLFCAGCRQGPSVWSCGEPVPRRIWVTASVTPSPRQALHPCSDSLDILKALHLLPAAFSPFIWVQVFAEPSNKESRGENDGGEERESANIY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LOC399886 uncharacterized LOC399886 [ Homo sapiens (human) ]
• Official Symbol: LOC399886
• Synonyms: LOC399886; uncharacterized LOC399886; FLJ41423
• Gene ID: 399886