Recombinant Human LOC399886 Protein, GST-tagged

Cat.No. : LOC399886-4337H
Product Overview : Human FLJ41423 full-length ORF ( ADR83482.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : LOC399886 (Uncharacterized LOC399886) is an RNA Gene, and is affiliated with the ncRNA class.
Molecular Mass : 18.4 kDa
AA Sequence : MAALSSRCPRSAAGPAYLQEAARSAHWASPPLVPLRTFQSSLFSSGSFHSREEEEEGVSLLRTALVGQGPVPLFLGSLFCAGCRQGPSVWSCGEPVPRRIWVTASVTPSPRQALHPCSDSLDILKALHLLPAAFSPFIWVQVFAEPSNKESRGENDGGEERESANIY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LOC399886 uncharacterized LOC399886 [ Homo sapiens (human) ]
Official Symbol LOC399886
Synonyms LOC399886; uncharacterized LOC399886; FLJ41423
Gene ID 399886

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LOC399886 Products

Required fields are marked with *

My Review for All LOC399886 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon