Recombinant Human LMO4 protein, GST-tagged

• Cat.No.: LMO4-3179H
• Product Overview: Recombinant Human LMO4 protein(P61968)(1-165aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-165aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 45 kDa
• AA Sequence: MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: LMO4 LIM domain only 4 [ Homo sapiens ]
• Official Symbol: LMO4
• Synonyms: LMO4; LIM domain only 4; LIM domain transcription factor LMO4; LMO-4; breast tumor autoantigen; LIM domain only protein 4
• Gene ID: 8543
• mRNA Refseq: NM_006769
• Protein Refseq: NP_006760
• MIM: 603129
• UniProt ID: P61968