Recombinant Human LINC02145 Protein, GST-tagged

Cat.No. : LINC02145-4309H
Product Overview : Human FLJ33360 full-length ORF ( ADR83476.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : LINC02145 (Long Intergenic Non-Protein Coding RNA 2145) is an RNA Gene, and is affiliated with the non-coding RNA class.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 14.3 kDa
AA Sequence : MDGTCIERRRQWYRDDLPLCFKKEENPPSNNVDGPGGCYAKCKKKREGQMLHDLIPMGPATATSFLTEDIGLAFYQVSPLLGFLCLLSQDTWNMYTCPRWIGRSAEPPSAACQAGGTRLLGTLHSPALLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LINC02145 long intergenic non-protein coding RNA 2145 [ Homo sapiens (human) ]
Official Symbol LINC02145
Synonyms LINC02145; long intergenic non-protein coding RNA 2145; CTD-2324F15.2
Gene ID 401172

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LINC02145 Products

Required fields are marked with *

My Review for All LINC02145 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon