Recombinant Human LIN28A Protein

• Cat.No.: LIN28A-29947TH
• Product Overview: Recombinant Human LIN28 produced in E. coli is a single, non-glycosylated polypeptide chain containing 222 amino acids (including 13- residue C-terminal TAT peptide).

Specification

• Species: Human
• Source: E.coli
• Tag: TAT
• Description: This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.
• Form: Sterile filtered colorless solution.
• Molecular Mass: 24.4 kDa
• AA Sequence: GPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQNGGYGRKKRRQRRR.
• Purity: Greater than 90% as determined by SDS-PAGE (coomassie staining).
• Notes: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
• Storage: Store at 4 centigrade if entire vial will be used within 2-4 weeks.
  Store, frozen at -20 centigrade for longer periods of time.
  For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  Avoid multiple freeze-thaw cycles.
• Storage Buffer: The LIN28 protein solution was formulated in PBS with 50mM arginine
• Shipping: Shipped with Ice Packs

Gene Information

• Gene Name: LIN28A lin-28 homolog A [ Homo sapiens (human) ]
• Official Symbol: LIN28A
• Synonyms: LIN28A; lin-28 homolog A; CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A; protein lin-28 homolog A; RNA-binding protein LIN-28; zinc finger CCHC domain-containing protein 1; zinc finger, CCHC domain containing 1
• Gene ID: 79727
• mRNA Refseq: NM_024674
• Protein Refseq: NP_078950
• MIM: 611043
• UniProt ID: Q9H9Z2