Recombinant Human LIN28A protein(1-209aa), His-PDI-tagged

• Cat.No.: LIN28A-5322H
• Product Overview: Recombinant Human LIN28A protein(Q9H9Z2)(1-209aa), fused with N-terminal His-PDI tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: N-His-PDI
• ProteinLength: 1-209aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 81.6 kDa
• AASequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: LIN28A lin-28 homolog A (C. elegans) [ Homo sapiens ]
• Official Symbol: LIN28A
• Synonyms: LIN28A; lin-28 homolog A (C. elegans); lin 28 homolog (C. elegans) , LIN28; protein lin-28 homolog A; CSDD1; FLJ12457; LIN 28; ZCCHC1; RNA-binding protein LIN-28; zinc finger, CCHC domain containing 1; zinc finger CCHC domain-containing protein 1; LIN28; LIN-28; lin-28A
• Gene ID: 79727
• mRNA Refseq: NM_024674
• Protein Refseq: NP_078950
• MIM: 611043
• UniProt ID: Q9H9Z2