Recombinant Human LILRB2 Protein, His-tagged

• Cat.No.: LILRB2-01H
• Product Overview: Recombinant human LILRB2 (24-461aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Description: This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Liquid
• Molecular Mass: 48.3 kDa (444aa)
• AA Sequence: GTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGV
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: In Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol
• Protein length: 24-461 a.a.

Gene Information

• Gene Name: LILRB2 leukocyte immunoglobulin like receptor B2 [ Homo sapiens (human) ]
• Official Symbol: LILRB2
• Synonyms: LILRB2; leukocyte immunoglobulin like receptor B2; ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10; leukocyte immunoglobulin-like receptor subfamily B member 2; CD85 antigen-like family member D; Ig-like transcript 4; leucocyte Ig-like receptor B2; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2; monocyte/macrophage immunoglobulin-like receptor 10; myeloid inhibitory receptor 10
• Gene ID: 10288
• mRNA Refseq: NM_005874
• Protein Refseq: NP_005865
• MIM: 604815
• UniProt ID: Q8N423