Recombinant Human LIF, StrepII-tagged

• Cat.No.: LIF-217H
• Product Overview: Purified, full-length human recombinant Leukemia inhibitory factor or LIF protein (amino acids 23-202, 180 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.7 kDa. (Accession NP_002300.1; UniProt P15018)

Specification

• Species: Human
• Source: Human Cells
• Tag: StrepII
• ProteinLength: 23-202, 180 a.a.
• Description: LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGT EKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDT SGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: LIF leukemia inhibitory factor [ Homo sapiens ]
• Official Symbol: LIF
• Synonyms: LIF; leukemia inhibitory factor; CDF; cholinergic differentiation factor; DIA; differentiation inhibitory activity; differentiation inducing factor; hepatocyte stimulating factor III; HILDA; human interleukin in DA cells; D factor; melanoma-derived LPL inhibitor; differentiation-inducing factor; hepatocyte-stimulating factor III; differentiation-stimulating factor; MLPLI
• Gene ID: 3976
• mRNA Refseq: NM_001257135
• Protein Refseq: NP_001244064
• MIM: 159540
• UniProt ID: P15018
• Chromosome Location: 22q12.2
• Pathway: Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Direct p53 effectors, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem
• Function: cytokine activity; growth factor activity; leukemia inhibitory factor receptor binding; leukemia inhibitory factor receptor binding; receptor binding