Recombinant Human LHFPL2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LHFPL2-2574H
• Product Overview: LHFPL2 MS Standard C13 and N15-labeled recombinant protein (NP_005770) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. Alternatively spliced transcript variants have been found, but their biological validity has not been determined.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 24.3 kDa
• AA Sequence: MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LHFPL2 lipoma HMGIC fusion partner-like 2 [ Homo sapiens (human) ]
• Official Symbol: LHFPL2
• Synonyms: LHFPL2; lipoma HMGIC fusion partner-like 2; lipoma HMGIC fusion partner-like 2 protein; KIAA0206; LHFP-like protein 2; DKFZp781E0375
• Gene ID: 10184
• mRNA Refseq: NM_005779
• Protein Refseq: NP_005770
• MIM: 609718
• UniProt ID: Q6ZUX7