Recombinant Human LHFPL2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LHFPL2-2574H
Product Overview : LHFPL2 MS Standard C13 and N15-labeled recombinant protein (NP_005770) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. Alternatively spliced transcript variants have been found, but their biological validity has not been determined.
Molecular Mass : 24.3 kDa
AA Sequence : MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LHFPL2 lipoma HMGIC fusion partner-like 2 [ Homo sapiens (human) ]
Official Symbol LHFPL2
Synonyms LHFPL2; lipoma HMGIC fusion partner-like 2; lipoma HMGIC fusion partner-like 2 protein; KIAA0206; LHFP-like protein 2; DKFZp781E0375;
Gene ID 10184
mRNA Refseq NM_005779
Protein Refseq NP_005770
MIM 609718
UniProt ID Q6ZUX7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LHFPL2 Products

Required fields are marked with *

My Review for All LHFPL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon