Recombinant Human LHCGR protein, His-tagged

• Cat.No.: LHCGR-023H
• Product Overview: Recombinant Human LHCGR protein(NP_000224)(49-219 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: 49-219 aa
• AA Sequence: AGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: LHCGR luteinizing hormone/choriogonadotropin receptor [ Homo sapiens ]
• Official Symbol: LHCGR
• Synonyms: LHCGR; luteinizing hormone/choriogonadotropin receptor; HHG, hypergonadotropic hypogonadism; lutropin-choriogonadotropic hormone receptor; LCGR; LGR2; LHR; ULG5; hypergonadotropic hypogonadism; lutropin/choriogonadotropin receptor; HHG; LHRHR; LSH-R; LH/CGR; LH/CG-R; FLJ41504
• Gene ID: 3973
• mRNA Refseq: NM_000233
• Protein Refseq: NP_000224
• MIM: 152790
• UniProt ID: P22888