Recombinant Human LGMN protein, T7/His-tagged
Cat.No. : | LGMN-216H |
Product Overview : | Recombinant human LGMN (416aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFVPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPD EQIVVMMYDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQ DHVFIYFTDHGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAANPR ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKVMQFQGMKR KASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEV EQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | LGMN legumain [ Homo sapiens ] |
Official Symbol | LGMN |
Synonyms | LGMN; legumain; protease, cysteine, 1 (legumain) , PRSC1; LGMN1; cysteine protease 1; protease, cysteine 1; asparaginyl endopeptidase; protease, cysteine, 1 (legumain); AEP; PRSC1; |
Gene ID | 5641 |
mRNA Refseq | NM_001008530 |
Protein Refseq | NP_001008530 |
MIM | 602620 |
UniProt ID | Q99538 |
Chromosome Location | 14q32.12 |
Pathway | Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolism, organism-specific biosystem; |
Function | cysteine-type endopeptidase activity; cysteine-type endopeptidase activity; peptidase activity; |
◆ Recombinant Proteins | ||
LGMN-674H | Recombinant Human LGMN protein, His-tagged | +Inquiry |
Lgmn-1059M | Active Recombinant Mouse Lgmn Protein, His-tagged | +Inquiry |
LGMN-2623H | Recombinant Human LGMN Protein (Ile18-Tyr433), His tagged | +Inquiry |
Lgmn-5062M | Recombinant Mouse Lgmn Protein, His (Fc)-Avi-tagged | +Inquiry |
LGMN-3669H | Recombinant Human LGMN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGMN-2893MCL | Recombinant Mouse LGMN cell lysate | +Inquiry |
LGMN-001SCL | Recombinant Sus scrofa (Pig) LGMN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LGMN Products
Required fields are marked with *
My Review for All LGMN Products
Required fields are marked with *
0
Inquiry Basket