Recombinant Human LDHC protein, His-SUMO-tagged
Cat.No. : | LDHC-3159H |
Product Overview : | Recombinant Human LDHC protein(P07864)(2-332aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-332aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.2 kDa |
AA Sequence : | STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LDHC lactate dehydrogenase C [ Homo sapiens ] |
Official Symbol | LDHC |
Synonyms | LDHC; lactate dehydrogenase C; L-lactate dehydrogenase C chain; cancer/testis antigen 32; CT32; LDH-C; LDH-X; LDH testis subunit; lactate dehydrogenase C4; lactate dehydrogenase c variant 1; lactate dehydrogenase c variant 3; lactate dehydrogenase c variant 4; LDH3; LDHX; MGC111073; |
Gene ID | 3948 |
mRNA Refseq | NM_002301 |
Protein Refseq | NP_002292 |
MIM | 150150 |
UniProt ID | P07864 |
◆ Recombinant Proteins | ||
LDHC-295H | Recombinant Human LDHC Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
LDHC-1285H | Recombinant Human LDHC Protein, His (Fc)-Avi-tagged | +Inquiry |
LDHC-5022M | Recombinant Mouse LDHC Protein, His (Fc)-Avi-tagged | +Inquiry |
LDHC-9023M | Recombinant Mouse LDHC Protein | +Inquiry |
LDHC-259H | Recombinant Human LDHC, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
LDHC-28045TH | Native Human LDHC | +Inquiry |
LDH3-222H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHC-4786HCL | Recombinant Human LDHC 293 Cell Lysate | +Inquiry |
LDHC-4787HCL | Recombinant Human LDHC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LDHC Products
Required fields are marked with *
My Review for All LDHC Products
Required fields are marked with *
0
Inquiry Basket