Recombinant Human LAT Protein, His-tagged

Source :	E. coli
Species :	Human
Tag :	His
Protein length :	30-113 aa
Molecular Mass :	10 kDa
AA Sequence :	MHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEHHHHHHHH
Purity :	>90% by SDS-PAGE
Storage :	Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration :	0.61mg/ml by BCA
Storage Buffer :	Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose

Gene Name	LAT linker for activation of T cells [ Homo sapiens (human) ]
Official Symbol	LAT
Synonyms	LAT1; pp36; IMD52; LAT
Gene ID	27040
MIM	602354
UniProt ID	O43561