Recombinant Human LAPTM4A protein, GST-tagged

• Cat.No.: LAPTM4A-301425H
• Product Overview: Recombinant Human LAPTM4A (103-187 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Ser103-Tyr187
• AA Sequence: SYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLINCVWNCY
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: LAPTM4A lysosomal protein transmembrane 4 alpha [ Homo sapiens ]
• Official Symbol: LAPTM4A
• Synonyms: LAPTM4A; lysosomal protein transmembrane 4 alpha; lysosomal associated protein transmembrane 4 alpha , MBNT; lysosomal-associated transmembrane protein 4A; HUMORF13; KIAA0108; LAPTM4; Mtrp; membrane nucleoside transporter; golgi 4-transmembrane-spanning transporter MTP; lysosomal-associated protein transmembrane 4 alpha; MBNT
• Gene ID: 9741
• mRNA Refseq: NM_014713
• Protein Refseq: NP_055528
• UniProt ID: Q15012