Recombinant Human LAMP2 protein(131-230 aa), C-His-tagged
Cat.No. : | LAMP2-2647H |
Product Overview : | Recombinant Human LAMP2 protein(P13473)(131-230 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 131-230 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGND |
Gene Name | LAMP2 lysosomal-associated membrane protein 2 [ Homo sapiens ] |
Official Symbol | LAMP2 |
Synonyms | LAMP2; lysosomal-associated membrane protein 2; lysosome-associated membrane glycoprotein 2; CD107b; CD107 antigen-like family member B; lysosome-associated membrane protein 2; LAMPB; LAMP-2; LGP110; |
Gene ID | 3920 |
mRNA Refseq | NM_001122606 |
Protein Refseq | NP_001116078 |
MIM | 309060 |
UniProt ID | P13473 |
◆ Recombinant Proteins | ||
LAMP2-4418H | Recombinant Human LAMP2 Protein, His-tagged | +Inquiry |
Lamp2-6994R | Recombinant Rat Lamp2 protein, His-tagged | +Inquiry |
LAMP2-3391H | Recombinant Human LAMP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL34345CF | Recombinant Full Length Cricetulus Griseus Lysosome-Associated Membrane Glycoprotein 2(Lamp2) Protein, His-Tagged | +Inquiry |
LAMP2-1145C | Recombinant Chicken LAMP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAMP2-1756MCL | Recombinant Mouse LAMP2 cell lysate | +Inquiry |
LAMP2-987CCL | Recombinant Cynomolgus LAMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAMP2 Products
Required fields are marked with *
My Review for All LAMP2 Products
Required fields are marked with *
0
Inquiry Basket