Recombinant Human LAMP2 protein(131-230 aa), C-His-tagged

• Cat.No.: LAMP2-2647H
• Product Overview: Recombinant Human LAMP2 protein(P13473)(131-230 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 131-230 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: DKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGND
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: LAMP2 lysosomal-associated membrane protein 2 [ Homo sapiens ]
• Official Symbol: LAMP2
• Synonyms: LAMP2; lysosomal-associated membrane protein 2; lysosome-associated membrane glycoprotein 2; CD107b; CD107 antigen-like family member B; lysosome-associated membrane protein 2; LAMPB; LAMP-2; LGP110
• Gene ID: 3920
• mRNA Refseq: NM_001122606
• Protein Refseq: NP_001116078
• MIM: 309060
• UniProt ID: P13473