Recombinant Human L1CAM protein, GST-tagged

• Cat.No.: L1CAM-3758H
• Product Overview: Recombinant Human L1CAM protein(460-660 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 460-660 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: WLDEDGTTVLQDERFFPYANGTLGIRDLQANDTGRYFCLAANDQNNVTIMANLKVKDATQITQGPRSTIEKKGSRVTFTCQASFDPSLQPSITWRGDGRDLQELGDSDKYFIEDGRLVIHSLDYSDQGNYSCVASTELDVVESRAQLLVVGSPGPVPRLVLSDLHLLTQSQVRVSWSPAEDHNAPIEKYDIEFEDKEMAPE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: L1CAM L1 cell adhesion molecule [ Homo sapiens ]
• Official Symbol: L1CAM
• Synonyms: L1CAM; L1 cell adhesion molecule; antigen identified by monoclonal R1 , HSAS, HSAS1, MASA, MIC5, S10, SPG1; neural cell adhesion molecule L1; CD171; antigen identified by monoclonal R1; S10; HSAS; MASA; MIC5; SPG1; CAML1; HSAS1; N-CAML1; NCAM-L1; N-CAM-L1
• Gene ID: 3897
• mRNA Refseq: NM_000425
• Protein Refseq: NP_000416
• MIM: 308840
• UniProt ID: P32004