Recombinant Human KYAT3 Protein, GST-Tagged

• Cat.No.: KYAT3-0494H
• Product Overview: Human CCBL2 full-length ORF (NP_001008661.1, 1 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. [provided by RefSeq, Mar 2017]
• Molecular Mass: 77.8 kDa
• AA Sequence: MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KYAT3 kynurenine aminotransferase 3 [ Homo sapiens (human) ]
• Official Symbol: KYAT3
• Synonyms: KYAT3; kynurenine aminotransferase 3; KAT3; KATIII; RP11-82K18.3; RP4-531M19.2; Kynurenine Aminotransferase 3; Kynurenine--Oxoglutarate Transaminase III; Kynurenine--Oxoglutarate Transaminase 3; Kynurenine--Glyoxylate Transaminase; Cysteine-S-Conjugate Beta-Lyase 2; Kynurenine Aminotransferase III; CCBL2; Cysteine Conjugate Beta Lyase
• Gene ID: 56267
• mRNA Refseq: NM_001008662
• Protein Refseq: NP_001008662
• MIM: 610656
• UniProt ID: Q6YP21