Recombinant Human KRT7 Protein, GST-tagged
Cat.No. : | KRT7-4843H |
Product Overview : | Human KRT7 full-length ORF ( AAH02700.1, 1 a.a. - 469 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. [provided by RefSeq |
Molecular Mass : | 77.8 kDa |
AA Sequence : | MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRT7 keratin 7 [ Homo sapiens ] |
Official Symbol | KRT7 |
Synonyms | KRT7; keratin 7; keratin, type II cytoskeletal 7; CK7; cytokeratin 7; K2C7; K7; keratin; 55K type II cytoskeletal; type II cytoskeletal 7; sarcolectin; SCL; CK-7; keratin-7; cytokeratin-7; type-II keratin Kb7; type II mesothelial keratin K7; keratin, 55K type II cytoskeletal; keratin, simple epithelial type I, K7; MGC3625; MGC129731; |
Gene ID | 3855 |
mRNA Refseq | NM_005556 |
Protein Refseq | NP_005547 |
MIM | 148059 |
UniProt ID | P08729 |
◆ Recombinant Proteins | ||
KRT7-2447R | Recombinant Rhesus monkey KRT7 Protein, His-tagged | +Inquiry |
Krt7-2799R | Recombinant Rat Krt7 protein, His & S-tagged | +Inquiry |
KRT7-286H | Recombinant Human KRT7 Protein, GST-His-tagged | +Inquiry |
KRT7-2798H | Recombinant Human KRT7 protein, His & S-tagged | +Inquiry |
KRT7-2983R | Recombinant Rat KRT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT7-4864HCL | Recombinant Human KRT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRT7 Products
Required fields are marked with *
My Review for All KRT7 Products
Required fields are marked with *
0
Inquiry Basket