Recombinant Human KRT7 Protein, GST-tagged

Cat.No. : KRT7-4843H
Product Overview : Human KRT7 full-length ORF ( AAH02700.1, 1 a.a. - 469 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. [provided by RefSeq
Molecular Mass : 77.8 kDa
AA Sequence : MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRT7 keratin 7 [ Homo sapiens ]
Official Symbol KRT7
Synonyms KRT7; keratin 7; keratin, type II cytoskeletal 7; CK7; cytokeratin 7; K2C7; K7; keratin; 55K type II cytoskeletal; type II cytoskeletal 7; sarcolectin; SCL; CK-7; keratin-7; cytokeratin-7; type-II keratin Kb7; type II mesothelial keratin K7; keratin, 55K type II cytoskeletal; keratin, simple epithelial type I, K7; MGC3625; MGC129731;
Gene ID 3855
mRNA Refseq NM_005556
Protein Refseq NP_005547
MIM 148059
UniProt ID P08729

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KRT7 Products

Required fields are marked with *

My Review for All KRT7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon