Recombinant Human KRT1 Protein, GST-tagged

• Cat.No.: KRT1-4876H
• Product Overview: Human KRT1 partial ORF ( NP_006112, 387 a.a. - 496 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: HGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEESRMSGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRT1 keratin 1 [ Homo sapiens ]
• Official Symbol: KRT1
• Synonyms: KRT1; keratin 1; EHK1, epidermolytic hyperkeratosis 1; keratin, type II cytoskeletal 1; KRT1A; CK-1; cytokeratin 1; cytokeratin-1; 67 kDa cytokeratin; hair alpha protein; type-II keratin Kb1; epidermolytic hyperkeratosis 1; K1; CK1; EHK; EHK1; EPPK; NEPPK
• Gene ID: 3848
• mRNA Refseq: NM_006121
• Protein Refseq: NP_006112
• MIM: 139350
• UniProt ID: P04264