Recombinant Human KRR1 Protein, GST-tagged

• Cat.No.: KRR1-4877H
• Product Overview: Human KRR1 full-length ORF ( AAH26107.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: KRR1 (KRR1, Small Subunit Processome Component Homolog) is a Protein Coding gene. Diseases associated with KRR1 include Hiv-1. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include nucleic acid binding and RNA binding.
• Molecular Mass: 70 kDa
• AA Sequence: MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRR1 KRR1, small subunit (SSU) processome component, homolog (yeast) [ Homo sapiens ]
• Official Symbol: KRR1
• Synonyms: KRR1; KRR1, small subunit (SSU) processome component, homolog (yeast); HIV 1 Rev binding protein 2 , HIV 1 rev binding protein 2 , HRB2; KRR1 small subunit processome component homolog; RIP 1; Rev interacting protein; rev-interacting protein 1; HIV-1 Rev binding protein 2; HIV-1 Rev-binding protein 2; KRR-R motif-containing protein 1; HRB2; RIP-1
• Gene ID: 11103
• mRNA Refseq: NM_007043
• Protein Refseq: NP_008974
• MIM: 612817
• UniProt ID: Q13601