Recombinant Human KPNA3 Protein, GST-tagged

• Cat.No.: KPNA3-4895H
• Product Overview: Human KPNA3 partial ORF ( NP_002258, 422 a.a. - 521 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KPNA3 karyopherin alpha 3 (importin alpha 4) [ Homo sapiens ]
• Official Symbol: KPNA3
• Synonyms: KPNA3; karyopherin alpha 3 (importin alpha 4); importin subunit alpha-3; hSRP1; IPOA4; SRP1gamma; SRP4; qip2; SRP1-gamma; importin alpha 4; importin alpha-3; importin alpha Q2; importin-alpha-Q2; karyopherin subunit alpha-3; SRP1
• Gene ID: 3839
• mRNA Refseq: NM_002267
• Protein Refseq: NP_002258
• MIM: 601892
• UniProt ID: O00505