Recombinant Human KMO protein, GST-tagged
Cat.No. : | KMO-617H |
Product Overview : | Recombinant Human KMO protein(NP_003670)(107-407 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 107-407 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KMO kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) [ Homo sapiens ] |
Official Symbol | KMO |
Synonyms | KMO; kynurenine 3-monooxygenase (kynurenine 3-hydroxylase); kynurenine 3-monooxygenase; kynurenine 3-hydroxylase; dJ317G22.1; |
Gene ID | 8564 |
mRNA Refseq | NM_003679 |
Protein Refseq | NP_003670 |
MIM | 603538 |
UniProt ID | O15229 |
◆ Cell & Tissue Lysates | ||
KMO-951HCL | Recombinant Human KMO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KMO Products
Required fields are marked with *
My Review for All KMO Products
Required fields are marked with *
0
Inquiry Basket