Recombinant Human KLRG1 protein, GST-tagged

Description :	Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor (KLR) family, which is a group of transmembrane proteins preferentially expressed in NK cells. Studies in mice suggested that the expression of this gene may be regulated by MHC class I molecules. Alternatively spliced transcript variants have been reported, but their full-length natures have not yet been determined.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	47.6 kDa
AA Sequence :	MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSC PDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLN FSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKVRL
Applications :	Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Protein length :	1-189 a.a.

Gene Name	KLRG1 killer cell lectin-like receptor subfamily G, member 1 [ Homo sapiens ]
Official Symbol	KLRG1
Synonyms	KLRG1; killer cell lectin-like receptor subfamily G, member 1; killer cell lectin-like receptor subfamily G member 1; 2F1; C type lectin domain family 15; member A; CLEC15A; MAFA; MAFA L; MAFA-like receptor; ITIM-containing receptor MAFA-L; C-type lectin domain family 15 member A; C-type lectin domain family 15, member A; mast cell function-associated antigen (ITIM-containing); MAFA-L; MAFA-2F1; MAFA-LIKE; MGC13600;
Gene ID	10219
mRNA Refseq	NM_005810
Protein Refseq	NP_005801
MIM	604874
UniProt ID	Q96E93
Chromosome Location	12p13.31
Pathway	Adaptive Immune System, organism-specific biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem;
Function	binding; receptor activity; sugar binding;