Recombinant Human KLRF1 Protein, GST-tagged
Cat.No. : | KLRF1-4908H |
Product Overview : | Human KLRF1 full-length ORF ( AAH98166.1, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release (Kuttruff et al., 2009 [PubMed 18922855]).[supplied by OMIM, Oct 2009] |
Molecular Mass : | 40.4 kDa |
AA Sequence : | MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVPRPHFRLLYRKT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KLRF1 killer cell lectin-like receptor subfamily F, member 1 [ Homo sapiens ] |
Official Symbol | KLRF1 |
Synonyms | KLRF1; killer cell lectin-like receptor subfamily F, member 1; killer cell lectin-like receptor subfamily F member 1; CLEC5C; NKp80; lectin-like receptor F1; activating coreceptor NKp80; killer cell lectin-like receptor F1; C-type lectin domain family 5 member C; MGC119907; MGC119908; MGC119909; |
Gene ID | 51348 |
mRNA Refseq | NM_016523 |
Protein Refseq | NP_057607 |
MIM | 605029 |
UniProt ID | Q9NZS2 |
◆ Recombinant Proteins | ||
KLRF1-645C | Recombinant Cynomolgus KLRF1 Protein, His-tagged | +Inquiry |
KLRF1-113H | Recombinant Human KLRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRF1-5672H | Active Recombinant Human Killer Cell Lectin-Like Receptor Subfamily F, Member 1, Fc-tagged | +Inquiry |
KLRF1-2439R | Recombinant Rhesus monkey KLRF1 Protein, His-tagged | +Inquiry |
KLRF1-2260R | Recombinant Rhesus Macaque KLRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRF1-1034CCL | Recombinant Cynomolgus KLRF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLRF1 Products
Required fields are marked with *
My Review for All KLRF1 Products
Required fields are marked with *
0
Inquiry Basket