Recombinant Human KLRF1 Protein, GST-tagged

• Cat.No.: KLRF1-4908H
• Product Overview: Human KLRF1 full-length ORF ( AAH98166.1, 1 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release (Kuttruff et al., 2009 [PubMed 18922855]).[supplied by OMIM, Oct 2009]
• Molecular Mass: 40.4 kDa
• AA Sequence: MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVPRPHFRLLYRKT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KLRF1 killer cell lectin-like receptor subfamily F, member 1 [ Homo sapiens ]
• Official Symbol: KLRF1
• Synonyms: KLRF1; killer cell lectin-like receptor subfamily F, member 1; killer cell lectin-like receptor subfamily F member 1; CLEC5C; NKp80; lectin-like receptor F1; activating coreceptor NKp80; killer cell lectin-like receptor F1; C-type lectin domain family 5 member C; MGC119907; MGC119908; MGC119909
• Gene ID: 51348
• mRNA Refseq: NM_016523
• Protein Refseq: NP_057607
• MIM: 605029
• UniProt ID: Q9NZS2