Recombinant Human KITLG Protein, His-tagged

• Cat.No.: KITLG-129H
• Product Overview: Recombinant Human Stem Cell Factor is produced by our Mammalian expression system and the target gene encoding Glu26-His214 is expressed with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: Glu26-His214
• Description: Stem Cell Factor (SCF) is a hematopoietic growth factor that exerts its activity at the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
• AA Sequence: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISE GLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDC VVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSS SSNRKAKNPPGDSSLHVDHHHHHH
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100μg/ml.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: KITLG KIT ligand [ Homo sapiens (human) ]
• Official Symbol: KITLG
• Synonyms: Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; c-Kit ligand; SCF; SF; MGF; SLF; DCUA; FPH2; FPHH; KL-1; Kitl; WS2F; SHEP7; DFNA69
• Gene ID: 4254
• mRNA Refseq: NM_000899.5
• Protein Refseq: NP_000890.1
• MIM: 184745
• UniProt ID: P21583