Recombinant Human KIFC1 protein, GST-tagged

• Cat.No.: KIFC1-43H
• Product Overview: Recombinant Human KIFC1(53 a.a. - 152 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 53-152 a.a.
• Description: KIFC1 played an important role in many functions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.41 kDa
• AA Sequence: MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTV PQTQGQTTAQKVSKKTGPRCSTAIA
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: KIFC1 kinesin family member C1 [ Homo sapiens ]
• Official Symbol: KIFC1
• Synonyms: KIFC1; kinesin family member C1; kinesin like 2 , KNSL2; kinesin-like protein KIFC1; HSET; kinesin-like 2; kinesin-like protein 2; kinesin-related protein HSET; KNSL2; MGC1202; MGC149736; MGC149737
• Gene ID: 3833
• mRNA Refseq: NM_002263
• Protein Refseq: NP_002254
• MIM: 603763
• UniProt ID: Q9BW19
• Chromosome Location: 6p21.32
• Pathway: Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Kinesins, organism-specific biosystem
• Function: ATP binding; microtubule motor activity; nucleotide binding