Recombinant Human KDR Protein (20-764aa), C-hIgG-His tagged
Cat.No. : | KDR-06H |
Product Overview : | Recombinant human KDR protein (20-764aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Fc&His |
Protein Length : | 20-764aa |
Description : | Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. The signalling and trafficking of this receptor are regulated by multiple factors, including Rab GTPase, P2Y purine nucleotide receptor, integrin alphaVbeta3, T-cell protein tyrosine phosphatase, etc.. Mutations of this gene are implicated in infantile capillary hemangiomas. |
Form : | Liquid |
Molecular Mass : | 110.5 kDa (987aa) |
AA Sequence : | < ADP> ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLE< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH> |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | KDR kinase insert domain receptor (a type III receptor tyrosine kinase) [ Homo sapiens (human) ] |
Official Symbol | KDR |
Synonyms | KDR; kinase insert domain receptor (a type III receptor tyrosine kinase); vascular endothelial growth factor receptor 2; CD309; FLK1; VEGFR; VEGFR2; soluble VEGFR2; fetal liver kinase 1; fetal liver kinase-1; protein-tyrosine kinase receptor Flk-1; tyrosine kinase growth factor receptor; |
Gene ID | 3791 |
mRNA Refseq | NM_002253 |
Protein Refseq | NP_002244 |
MIM | 191306 |
UniProt ID | P35968 |
◆ Recombinant Proteins | ||
Kdr-071M | Recombinant Mouse Kdr Protein, His-tagged | +Inquiry |
Kdr-6866M | Recombinant Mouse Kdr protein, His-tagged | +Inquiry |
KDR-643HP | Recombinant Human KDR protein, Fc-tagged, R-PE labeled | +Inquiry |
KDR-4331H | Recombinant Human KDR Protein (Met1-Lys327), C-His tagged | +Inquiry |
KDR-8718RAF488 | Recombinant Rat Kdr Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDR-1520MCL | Recombinant Mouse KDR cell lysate | +Inquiry |
KDR-417HCL | Recombinant Human KDR cell lysate | +Inquiry |
KDR-1769HCL | Recombinant Human KDR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KDR Products
Required fields are marked with *
My Review for All KDR Products
Required fields are marked with *
0
Inquiry Basket