Recombinant Human KDR protein(1201-1300 aa), C-His-tagged
Cat.No. : | KDR-2742H |
Product Overview : | Recombinant Human KDR protein(P35968)(1201-1300 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1201-1300 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSN |
Gene Name | KDR kinase insert domain receptor (a type III receptor tyrosine kinase) [ Homo sapiens ] |
Official Symbol | KDR |
Synonyms | KDR; kinase insert domain receptor (a type III receptor tyrosine kinase); vascular endothelial growth factor receptor 2; CD309; FLK1; VEGFR; VEGFR2; soluble VEGFR2; fetal liver kinase 1; fetal liver kinase-1; protein-tyrosine kinase receptor Flk-1; tyrosine kinase growth factor receptor; |
Gene ID | 3791 |
mRNA Refseq | NM_002253 |
Protein Refseq | NP_002244 |
MIM | 191306 |
UniProt ID | P35968 |
◆ Recombinant Proteins | ||
KDR-2895R | Recombinant Rat KDR Protein, His (Fc)-Avi-tagged | +Inquiry |
KDR-645HF | Active Recombinant Human KDR Protein, Fc-tagged, FITC conjugated | +Inquiry |
Kdr-7413MF | Recombinant Mouse Kdr Protein, Fc-tagged, FITC conjugated | +Inquiry |
KDR-1187C | Recombinant Chicken KDR | +Inquiry |
KDR-8718R | Active Recombinant Rat KDR protein(Met1-Glu760), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDR-417HCL | Recombinant Human KDR cell lysate | +Inquiry |
KDR-1520MCL | Recombinant Mouse KDR cell lysate | +Inquiry |
KDR-1769HCL | Recombinant Human KDR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KDR Products
Required fields are marked with *
My Review for All KDR Products
Required fields are marked with *
0
Inquiry Basket