Recombinant Human KCTD15 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KCTD15-919H
• Product Overview: KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_076981) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: KCTD15 (Potassium Channel Tetramerization Domain Containing 15) is a Protein Coding gene. Diseases associated with KCTD15 include Leptin Deficiency Or Dysfunction. Among its related pathways are Sweet Taste Signaling and Hepatic ABC Transporters. An important paralog of this gene is KCTD1.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 26.5 kDa
• AA Sequence: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KCTD15 potassium channel tetramerisation domain containing 15 [ Homo sapiens (human) ]
• Official Symbol: KCTD15
• Synonyms: KCTD15; potassium channel tetramerisation domain containing 15; BTB/POZ domain-containing protein KCTD15; MGC25497; MGC2628
• Gene ID: 79047
• mRNA Refseq: NM_024076
• Protein Refseq: NP_076981
• MIM: 615240
• UniProt ID: Q96SI1