Recombinant Human KCNN4 protein, GST-tagged

• Cat.No.: KCNN4-1224H
• Product Overview: Recombinant Human KCNN4 protein(304-427 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 304-427 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: DIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: KCNN4 potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4 [ Homo sapiens ]
• Official Symbol: KCNN4
• Synonyms: KCNN4; potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4; intermediate conductance calcium-activated potassium channel protein 4; hIKCa1; hKCa4; hSK4; KCa3.1; SKCa4; SKCa 4; putative Gardos channel; putative erythrocyte intermediate conductance calcium-activated potassium Gardos channel; IK1; SK4; KCA4; IKCA1
• Gene ID: 3783
• mRNA Refseq: NM_002250
• Protein Refseq: NP_002241
• MIM: 602754
• UniProt ID: O15554