Recombinant Human KCNN4 protein, GST-tagged

Cat.No. : KCNN4-1224H
Product Overview : Recombinant Human KCNN4 protein(304-427 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 304-427 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : DIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name KCNN4 potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4 [ Homo sapiens ]
Official Symbol KCNN4
Synonyms KCNN4; potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4; intermediate conductance calcium-activated potassium channel protein 4; hIKCa1; hKCa4; hSK4; KCa3.1; SKCa4; SKCa 4; putative Gardos channel; putative erythrocyte intermediate conductance calcium-activated potassium Gardos channel; IK1; SK4; KCA4; IKCA1;
Gene ID 3783
mRNA Refseq NM_002250
Protein Refseq NP_002241
MIM 602754
UniProt ID O15554

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KCNN4 Products

Required fields are marked with *

My Review for All KCNN4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon